PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 281aa    MW: 30593 Da    PI: 8.8888
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19517.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.91.3e-392382261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s
  KHN19517.1 23 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRS 82
                7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-301981IPR003851Zinc finger, Dof-type
PfamPF027015.8E-342481IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2642781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEGSKPPPPP PPPMLERRAR PQKDQALNCP RCNSTNTKFC YYNNYSLSQP RYFCKTCRRY  60
WTEGGSLRNV PVGGGSRKNK RSTPPAPPSA PAPTKKLSDL ATPNFPQSAS QDPKIHQGQD  120
LNLAYPPAED YSTVSKFIEV PYSTELDKGT TGLHQNPTSS STTTSASSQL SAMELLKTGI  180
AAASSRGLNS FMPMYNSTHG FPLQDFKPPH GLNFSLEGFE NGYGGLQGIQ EGPTGGARIL  240
FPTVEDLKQQ VPSTNEFDQQ NRSQEGSAHG YWNGMLGGGS W
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572710.0DQ857271.1 Glycine max Dof21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236777.10.0Dof21
RefseqXP_006577879.10.0PREDICTED: dof21 isoform X1
RefseqXP_014629855.10.0PREDICTED: dof21 isoform X1
TrEMBLA0A0B2QID30.0A0A0B2QID3_GLYSO; Dof zinc finger protein DOF4.6
TrEMBLI1JYN90.0I1JYN9_SOYBN; Uncharacterized protein
TrEMBLQ0GLD10.0Q0GLD1_SOYBN; Dof21
STRINGGLYMA04G41170.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.41e-49Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]